PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pavir.9KG609800.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Panicinae; Panicum
Family HD-ZIP
Protein Properties Length: 334aa    MW: 36720 Da    PI: 6.6294
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pavir.9KG609800.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox55.78.1e-18112165356
                          --SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
             Homeobox   3 kRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                          k+++++ eq+++Le+ Fe  +++  e++ +LA+ lgL+ rqV +WFqNrRa++k
  Pavir.9KG609800.1.p 112 KKRRLNVEQVRTLEKNFELGNKLEPERKLQLARALGLQPRQVAIWFQNRRARWK 165
                          4568999**********************************************9 PP

2HD-ZIP_I/II127.36.7e-41111201191
          HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLree 90 
                          ekkrrl+ eqv++LE++Fe  +kLeperK +lar+Lglqprqva+WFqnrRAR+ktkqlEkdy+aLkr++da+k++n+ L +++++L++e
  Pavir.9KG609800.1.p 111 EKKRRLNVEQVRTLEKNFELGNKLEPERKLQLARALGLQPRQVAIWFQNRRARWKTKQLEKDYDALKRQLDAVKADNDVLLSHNKKLQAE 200
                          69**************************************************************************************98 PP

          HD-ZIP_I/II  91 l 91 
                          +
  Pavir.9KG609800.1.p 201 I 201
                          7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.5E-1890168IPR009057Homeodomain-like
SuperFamilySSF466892.01E-19103169IPR009057Homeodomain-like
PROSITE profilePS5007117.346107167IPR001356Homeobox domain
SMARTSM003891.3E-17110171IPR001356Homeobox domain
PfamPF000463.2E-15112165IPR001356Homeobox domain
CDDcd000861.93E-17112168No hitNo description
PRINTSPR000311.6E-5138147IPR000047Helix-turn-helix motif
PROSITE patternPS000270142165IPR017970Homeobox, conserved site
PRINTSPR000311.6E-5147163IPR000047Helix-turn-helix motif
PfamPF021834.0E-13167207IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 334 aa     Download sequence    Send to blast
MRPMASNGMA SSPSPFFPPN FLLQMQQTPP DHDPQEHHHH HEHHLPPPLH PHHNPFLPSS  60
QCPSLQDFRG MAPMLGKRPM YGAEVGGVDE ANGGGGANED ELSDDGSQAG EKKRRLNVEQ  120
VRTLEKNFEL GNKLEPERKL QLARALGLQP RQVAIWFQNR RARWKTKQLE KDYDALKRQL  180
DAVKADNDVL LSHNKKLQAE ILALKGREAG SELINLNKET EASCSNRSEN SSEINLDISR  240
TPPSEGPMDP PPSHHHQHPS GGGGGMIPFY PPVGGRPAGV DIDQLLHSTS GPKLEQHGGG  300
GVQAPETASF GNLLCGVDEP PPFWPWADHQ HFH*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1159167RRARWKTKQ
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Pvr.185940.0stem
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEU9664900.0EU966490.1 Zea mays clone 294849 homeobox-leucine zipper protein HAT7 mRNA, complete cds.
GenBankKJ7285060.0KJ728506.1 Zea mays clone pUT6811 HB transcription factor (HB102) mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002465782.10.0hypothetical protein SORBIDRAFT_01g045740
RefseqXP_004985543.10.0PREDICTED: homeobox-leucine zipper protein HOX21 isoform X2
SwissprotQ8S7W91e-151HOX21_ORYSJ; Homeobox-leucine zipper protein HOX21
TrEMBLC5WVY20.0C5WVY2_SORBI; Putative uncharacterized protein Sb01g045740
TrEMBLK4ACB20.0K4ACB2_SETIT; Uncharacterized protein
STRINGSi036519m0.0(Setaria italica)
STRINGSb01g045740.10.0(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP22893894
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G69780.11e-79HD-ZIP family protein